General Information

  • ID:  hor006480
  • Uniprot ID:  Q9GLC7(143-175)
  • Protein name:  Osteostatin
  • Gene name:  PTHLH
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Parathyroid hormone family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0030282 bone mineralization
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  TRSAWPLSAGAGSGLAGDHLSDISEPEPELDSR
  • Length:  33(143-175)
  • Propeptide:  MLRRLVQQWSVAVFLLSYSVPSCGRSVEGPGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAANTKNHAVRFGSDDEGRYLTQETNKVEPYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWPLSAGAGSGLAGDHLSDISEPEPELDSRRH
  • Signal peptide:  MLRRLVQQWSVAVFLLSYSVPSCG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PTH1R
  • Target Unid:  G1T397
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GLC7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006480_AF2.pdbhor006480_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 395056 Formula: C143H224N42O53
Absent amino acids: CFKMNQVY Common amino acids: S
pI: 4.07 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -57.88 Boman Index: -6613
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 71.21
Instability Index: 6015.45 Extinction Coefficient cystines: 5500
Absorbance 280nm: 171.88

Literature

  • PubMed ID:  NA
  • Title:  NA